HSP90AA1 / Hsp90 Alpha A1 Antibody (aa454-488)
Product Sizes
100 ug
£ POA
LS-C407847-100UG
About this Product
- SKU:
- LS-C407847
- Additional Names:
- HSP90AA1, EL52, HSP86, Hsp89, HSP89A, HSPC1, Heat shock 86 kDa, Hsp90, HSP90A, HSP90N, HSPCA, HSPCAL4, HSPN, LAP2, HSP 86, HSPCAL1
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp90 alpha (454-488 aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420211
