GREM1 / Gremlin-1 Antibody (aa151-184)
Product Sizes
100 ug
£ POA
LS-C407838-100UG
About this Product
- SKU:
- LS-C407838
- Additional Names:
- GREM1, CKTSF1B1, DAN domain family member 2, DAND2, DRM, GREMLIN, Gremlin 1-like protein, Increased in high glucose-2, Gremlin-1, PIG2, Proliferation-inducing gene 2, Gremlin 1, IHG-2
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Gremlin 1 (151-184 aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Guinea Pig, Hamster, Human, Mouse, Other Mammal, Porcine, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Highly expressed in small intestine, fetal brain and colon. Expression is restricted to intestinal subepithelial myofibroblasts (ISEMFs) at the crypt base. In subjects with HMPS1, by contrast, GREM1 is expressed, not only in basal ISEMFs, but also at very high levels in epithelial cells (predominantly colonocytes), with expression extending most of the way up the sides of the crypt. Weakly express
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420202
