IGFBP1 Antibody (aa177-207)
Product Sizes
100 ug
£ POA
LS-C407817-100UG
About this Product
- SKU:
- LS-C407817
- Additional Names:
- IGFBP1, AFBP, Amniotic fluid binding protein, Binding protein-26, Binding protein-25, Binding protein-28, IGF-binding protein 1, IGF-BP25, IBP1, HIGFBP-1, PP12, Placental protein 12, IBP-1, IGFBP-1
- Application:
- ELISA, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of mouse IGFBP-1 (177-207 aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420181
