HTR2A / 5-HT2A Receptor Antibody (aa400-431)
Product Sizes
100 ug
£ POA
LS-C407811-100UG
About this Product
- SKU:
- LS-C407811
- Additional Names:
- HTR2A, 5-HT2A, 5-HT-2A, 5-HT2a receptor, 5HT2A Receptor, 5-HT-2, 5-HT2A/2C, 5-HT2A/2C receptor, 5-HT2 receptor, HTR2, Serotonin 5-HT-2A receptor, Serotonin receptor 2A, Serotonin 2a receptor
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human 5HT2A Receptor (400-431 aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Canine, Guinea Pig, Human, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Detected in brain cortex (at protein level). Detected in blood platelets. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420175
