EPHB1 / EPH Receptor B1 Antibody (aa56-88)
Product Sizes
100 ug
£ POA
LS-C407798-100UG
About this Product
- SKU:
- LS-C407798
- Additional Names:
- EPHB1, Cek6, EK6, ELK, Ephrin type-B receptor 1, Hek6, EPHT2, NET, EPH receptor B1, EPH tyrosine kinase 2, EPH-like kinase 6, Soluble EPHB1 variant 1
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Eph receptor B1 (56-88 aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Avian, Bovine, Guinea Pig, Horse, Human, Mouse, Other Mammal, Porcine, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Preferentially expressed in brain.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420162
