Osteonectin / SPARC Antibody (aa268-303)
Product Sizes
100 ug
£ POA
LS-C407772-100UG
About this Product
- SKU:
- LS-C407772
- Additional Names:
- SPARC, Basement-membrane protein 40, BM-40, Cysteine-rich protein, ON, Osteonectin
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SPARC (268-303 aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420136
