XRCC6 / Ku70 Antibody (aa464-496)
Product Sizes
100 ug
£ POA
LS-C407734-100UG
About this Product
- SKU:
- LS-C407734
- Additional Names:
- XRCC6, 5-dRP lyase Ku70, 70 kDa subunit of Ku antigen, CTCBF, DNA repair protein XRCC6, D22S671, D22S731, G22P1, Ku autoantigen, 70kDa, Ku autoantigen p70 subunit, Thyroid-lupus autoantigen p70, TLAA, CTC75, KU70, ML8, Thyroid-lupus autoantigen
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at C-Terminus of human Ku70 (464-496 aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420098
