ATXN2 / SCA2 / Ataxin-2 Antibody (aa1283-1313)
Product Sizes
100 ug
£ POA
LS-C407696-100UG
About this Product
- SKU:
- LS-C407696
- Additional Names:
- ATXN2, ASL13, Ataxin 2, ATX2, Ataxin-2, SCA2, TNRC13
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ATX2 (1283-1313 aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Guinea Pig, Hamster, Horse, Human, Mouse, Other Mammal, Porcine, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Expressed in the brain, heart, liver, skeletal muscle, pancreas and placenta. Isoform 1 is predominant in the brain and spinal cord. Isoform 4 is more abundant in the cerebellum. In the brain, broadly expressed in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420060
