AQP1 / Aquaporin 1 Antibody (aa240-269)
Product Sizes
100 ug
£ POA
LS-C407687-100UG
About this Product
- SKU:
- LS-C407687
- Additional Names:
- AQP1, Aquaporin-1, AQP-1, AQP-CHIP, Aquaporin 1, Aquaporin-CHIP, CHIP28, Colton blood group, Urine water channel, CO
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Aquaporin 1 (240-269 aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Human, Mouse, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420051
