AGER / RAGE Antibody (aa91-120)
Product Sizes
100 ug
£ POA
LS-C407683-100UG
About this Product
- SKU:
- LS-C407683
- Additional Names:
- AGER, RAGE, RAGE isoform NtRAGE-delta, RAGE isoform sRAGE-delta
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human RAGE (91-120 aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Endothelial cells.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420047
