TH / Tyrosine Hydroxylase Antibody (aa193-222)
Product Sizes
100 ug
£ POA
LS-C407661-100UG
About this Product
- SKU:
- LS-C407661
- Additional Names:
- TH, DYT14, Dystonia 14, TYH, Tyrosine 3-hydroxylase, Tyrosine hydroxylase, DYT5b, Tyrosine 3-monooxygenase
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222 aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Hamster, Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Mainly expressed in the brain and adrenal glands.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:420025
