ITGB2 / CD18 Antibody (aa24-54)
Product Sizes
100 ug
£ POA
LS-C388182-100UG
About this Product
- SKU:
- LS-C388182
- Additional Names:
- ITGB2, CD18 antigen, CD18, Integrin beta chain, beta 2, LCAMB, MAC-1, MFI7, MF17, Integrin beta-2, LAD, LFA-1
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide/thimerosal.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide from the N-Terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD, aa24-54 of UniProt P05107). Percent identity by BLAST analysis: Human (100%); Mouse (87%); Rat, Ferret, Sheep, Goat (84%); Bovine, Rabbit, Zebu, Dog (81%).
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human ITGB2 / CD18
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles., -20[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:400375
