EMA / MUC1 Antibody (aa1192-1241)
Product Sizes
0.1 mg
£ POA
LS-C364616-0.1MG
About this Product
- SKU:
- LS-C364616
- Additional Names:
- MUC1, CA15-3, CD227, Carcinoma-associated mucin, CD227 antigen, DF3 antigen, Episialin, Epithelial membrane antigen, H23 antigen, H23AG, Krebs von den Lungen-6, MAM6, MUC1/ZD, MUC-1/SEC, Mucin-1, Pem, KL-6, MUC-1/X, Tumor-associated mucin, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, PUM, EMA, MUC-1, Mucin 1, transmembrane
- Application:
- IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, 0.02% Sodium Azide
- Clonality:
- Polyclonal
- Concentration:
- 1 mg/ml
- Host:
- Rabbit
- Immunogen:
- Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C-Terminus of MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Guinea Pig, Horse, Human, Mouse, Porcine, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human EMA / MUC1. Human EMA / MUC1
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:376598
