ATP2A2 / SERCA2 Antibody (aa1-32)
Product Sizes
100 ug
£ POA
LS-C357605-100UG
About this Product
- SKU:
- LS-C357605
- Additional Names:
- ATP2A2, ATP2B, Calcium pump 2, DAR, SR Ca(2+)-ATPase 2, Cardiac Ca2+ ATPase, DD, SERCA2
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human SERCA2 ATPase (1-32 aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Guinea Pig, Horse, Human, Mouse, Non-human Primate, Porcine, Rabbit, Rat, Sheep
- Shipping Conditions:
- Ambient
- Specificity:
- Isoform 1 is widely expressed in smooth muscle and nonmuscle tissues such as in adult skin epidermis, with highest expression in liver, pancreas and lung, and intermediate expression in brain, kidney and placenta. Also expressed at lower levels in heart and skeletal muscle. Isoforms 2 and 3 are highly expressed in the heart and slow twitch skeletal muscle. Expression of isoform 3 is predominantly
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:368929
