ATP2A3 / SERCA3 Antibody (aa1-30)
Product Sizes
100 ug
£ POA
LS-C357603-100UG
About this Product
- SKU:
- LS-C357603
- Additional Names:
- ATP2A3, Calcium pump 3, SERCA3, SR Ca(2+)-ATPase 3, SERCA3b
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human ATP2A3(1-30 aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:368927
