AIFM1 / AIF / PDCD8 Antibody (aa582-613)
Product Sizes
100 ug
£ POA
LS-C357554-100UG
About this Product
- SKU:
- LS-C357554
- Additional Names:
- AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8
- Application:
- IHC-Paraffin, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human AIF(582-613 aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Hamster, Horse, Human, Mouse, Non-human Primate, Other Mammal, Porcine, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:368878
