MMP3 Antibody (aa410-439)
Product Sizes
100 ug
£ POA
LS-C357436-100UG
About this Product
- SKU:
- LS-C357436
- Additional Names:
- MMP3, CHDS6, MMP-3, Prostromelysin-1, Proteoglycanase, SL-1, STR1, Matrix metalloproteinase-3, Transin, Transin-1, SLN-1, STMY, Progelatinase, STMY1, Stromelysin-1
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human MMP3(410-439 aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:368760
