PCDHA13 Antibody
Product Sizes
100 ul
£ POA
LS-C349308-100UL
20 ul
£ POA
LS-C349308-20UL
About this Product
- SKU:
- LS-C349308
- Additional Names:
- PCDHA13, CRNR5, CNR5, CNRS5, KIAA0345-like 1, Protocadherin alpha 13, Protocadherin alpha-13, PCDH-alpha-13, CNRN5, Ortholog of mouse CNR5, PCDH-ALPHA13
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human PCDHA13 (NP_061727.1). GEIRTKGKLDFEEKKLYEISVEAVDKGNIPMAGHCTLLVEVLDVNDNAPEVTITSLSLPIR
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human PCDHA13
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:360429
