BAX Antibody
Product Sizes
100 ul
£ POA
LS-C349285-100UL
20 ul
£ POA
LS-C349285-20UL
About this Product
- SKU:
- LS-C349285
- Additional Names:
- BAX, BCL2-associated X protein, Bcl2-L-4, Apoptosis regulator BAX, Bcl-2-like protein 4, BCL2L4
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BAX (NP_620116.1). MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human BAX
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:360406
