CCL3 / MIP-1-Alpha Antibody
Product Sizes
100 ul
£ POA
LS-C349251-100UL
20 ul
£ POA
LS-C349251-20UL
About this Product
- SKU:
- LS-C349251
- Additional Names:
- CCL3, C-C motif chemokine 3, G0S19-1, Mip1alpha, SCYA3, SIS-beta, Chemokine (C-C motif) ligand 3, LD78ALPHA, MIP-1-alpha, MIP1A, PAT 464.1, Small-inducible cytokine A3
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human CCL3 (NP_002974.1). SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human CCL3 / MIP-1-Alpha
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:360372
