DCD / Dermcidin Antibody
Product Sizes
100 ul
£ POA
LS-C346322-100UL
20 ul
£ POA
LS-C346322-20UL
About this Product
- SKU:
- LS-C346322
- Additional Names:
- DCD, AIDD, Dermcidin, DSEP, DCD-1, HCAP, PIF, Preproteolysin, Proteolysis inducing factor, Survival promoting peptide
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human DCD (NP_444513.1). YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human DCD / Dermcidin
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:357272
