C10orf32 Antibody
Product Sizes
100 ul
£ POA
LS-C346319-100UL
20 ul
£ POA
LS-C346319-20UL
About this Product
- SKU:
- LS-C346319
- Additional Names:
- C10orf32, UPF0693 protein C10orf32, RP11-753C18.6
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human C10orf32 (NP_653192.2). MMATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human C10orf32
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:357269
