SNCA / Alpha-Synuclein Antibody
Product Sizes
100 ul
£ POA
LS-C346299-100UL
20 ul
£ POA
LS-C346299-20UL
About this Product
- SKU:
- LS-C346299
- Additional Names:
- SNCA, Alpha-synuclein, PARK4, PD1, Synuclein alpha-140, NACP, PARK1, aSynuclein, a-Synuclein
- Application:
- IHC-Paraffin, Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 61-140 of human SNCA (NP_000336.1). EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human SNCA / Alpha-Synuclein
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:357249
