ATP6AP2 / Renin Receptor Antibody
Product Sizes
100 ul
£ POA
LS-C346110-100UL
20 ul
£ POA
LS-C346110-20UL
About this Product
- SKU:
- LS-C346110
- Additional Names:
- ATP6AP2, APT6M8-9, ATP6M8-9, ELDF10, HT028, MSTP009, Renin receptor, M8-9, N14F, Renin/prorenin receptor, ATP6IP2, V-ATPase M8.9 subunit, CAPER, MRXE, XMRE
- Application:
- Immunofluorescence, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 0.764 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 251-350 of human ATP6AP2 (NP_005756.2). MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human ATP6AP2 / Renin Receptor.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:357060
