FRA-1 / FOSL1 Antibody
Product Sizes
100 ul
£ POA
LS-C346075-100UL
20 ul
£ POA
LS-C346075-20UL
About this Product
- SKU:
- LS-C346075
- Additional Names:
- FOSL1, FOS-like antigen 1, Fos-related antigen 1, FRA, FOS-like antigen-1, FRA1, Fra-1
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FOSL1 (NP_005429.1). MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human FRA-1 / FOSL1
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:357025
