APLNR/ Apelin Receptor / APJ Antibody
Product Sizes
100 ul
£ POA
LS-C346068-100UL
20 ul
£ POA
LS-C346068-20UL
About this Product
- SKU:
- LS-C346068
- Additional Names:
- APLNR, AGTRL1, Angiotensin receptor-like 1, Angiotensin II receptor-like 1, Apelin receptor, APJ, APJ (apelin) receptor, APJR, G protein-coupled receptor APJ, HG11 orphan receptor, HG11, APJ receptor, G-protein coupled receptor APJ
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 301-380 of human APLNR (NP_005152.1). NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human APLNR/ Apelin Receptor / APJ.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:357018
