CBFA1 / RUNX2 Antibody (aa244-278)
Product Sizes
100 ug
£ POA
LS-C344017-100UG
About this Product
- SKU:
- LS-C344017
- Additional Names:
- RUNX2, AML3, CCD, CCD1, OSF2, PEBP2A1, PEBP2A2, PEA2-alpha A, PEBP2-alpha A, OSF-2, PEBP2A, PEBP2aA1, CBF-alpha-1, CBFA1, Oncogene AML-3, PEA2aA, PEBP2aA
- Application:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278 aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Non-human Primate, Porcine
- Shipping Conditions:
- Ambient
- Specificity:
- Specifically expressed in osteoblasts.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:354881
