HSPD1 / HSP60 Antibody (Preservative Free, Biotin)
Product Sizes
50 ug
£ POA
LS-C343493-50UG
About this Product
- SKU:
- LS-C343493
- Additional Names:
- HSPD1, 60 kDa chaperonin, CPN60, Heat shock protein 65, Heat shock protein 60, HSP-60, HSP60, HuCHA60, HLD4, HSP65, p60 lymphocyte protein, SPG13, Chaperonin 60, GROEL
- Application:
- ELISA
- Buffer:
- Lyophilized from PBS, No preservatives added
- Clonality:
- Polyclonal
- Conjugate:
- Biotin
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide derived from human HSP60. Immunogen Sequence: CAIATGGAVFGEEGLTLNLEDVQPHDLGK.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Protein A/G Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- The antibody can specifically bind to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. The specificity for binding to recombinant protein, cellular protein and native antigen is not defined. Cross reactivity with mouse and rat HSP60 has not yet been tested.
- Storage Conditions:
- -20[o]C/-70[o]C Avoid freeze/thaw cycles., 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:354333
