IL1RAPL1 Antibody
Product Sizes
100 ul
£ POA
LS-C335335-100UL
20 ul
£ POA
LS-C335335-20UL
About this Product
- SKU:
- LS-C335335
- Additional Names:
- IL1RAPL1, IL1RAPL, Interleukin 1 receptor-8, MRX10, MRX34, Oligophrenin-4, IL-1-RAPL-1, IL-1RAPL-1, IL1R8, TIGIRR-2, MRX21, IL1RAPL-1, OPHN4
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human IL1RAPL1 (NP_055086.1). SISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDD
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human IL1RAPL1.
- Storage Conditions:
- -70[o]C Avoid freeze/thaw cycles., -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:345694
