CXCL10 / IP-10 Antibody
Product Sizes
100 ul
£ POA
LS-C335160-100UL
20 ul
£ POA
LS-C335160-20UL
About this Product
- SKU:
- LS-C335160
- Additional Names:
- CXCL10, C-X-C motif chemokine 10, Gamma-IP10, IP-10, Gamma IP10, GIP-10, Mob-1, Small-inducible cytokine B10, Crg-2, IFI10, INP10, SCYB10
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 20-98 of human CXCL10 (NP_001556.2). QGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human CXCL10 / IP-10
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:345519
