AGPAT1 Antibody
Product Sizes
100 ul
£ POA
LS-C334770-100UL
20 ul
£ POA
LS-C334770-20UL
About this Product
- SKU:
- LS-C334770
- Additional Names:
- AGPAT1, 1-AGP acyltransferase 1, 1-AGPAT 1, 1-AGPAT1, G15, LPAAT-alpha, LPAATA, Protein G15
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 204-283 of human AGPAT1 (NP_006402.1). PIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human AGPAT1
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:345129
