CXCL11 Antibody
Product Sizes
100 ul
£ POA
LS-C334557-100UL
20 ul
£ POA
LS-C334557-20UL
About this Product
- SKU:
- LS-C334557
- Additional Names:
- CXCL11, Beta-R1, Chemokine h174, Chemokine ip-9, Chemokine itac, H174, I-TAC, IP9, ITAC, IP-9, SCYB11, Small inducible cytokine B11, B-R1, C-X-C motif chemokine 11, SCYB9B, Small-inducible cytokine B11
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CXCL11 (NP_005400.1). FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human CXCL11
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:344916
