VISA / MAVS Antibody
Product Sizes
100 ul
£ POA
LS-C334271-100UL
20 ul
£ POA
LS-C334271-20UL
About this Product
- SKU:
- LS-C334271
- Additional Names:
- MAVS, CARDIF, CARD adaptor inducing IFN-beta, IPS-1, KIAA1271, IFN-B promoter stimulator 1, VISA, IPS1
- Application:
- Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MAVS (NP_065797.2). MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRR
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human VISA / MAVS
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:344630
