HTR2B / 5-HT2B Receptor Antibody
Product Sizes
100 ul
£ POA
LS-C334205-100UL
20 ul
£ POA
LS-C334205-20UL
About this Product
- SKU:
- LS-C334205
- Additional Names:
- HTR2B, 5-HT 2B receptor, 5HT2B Receptor, 5-HT(2B), 5-HT-2B, 5-HT2b receptor, 5-HT2B, Serotonin 2b receptor, Serotonin 5-HT-2b receptor, Serotonin receptor 2B
- Application:
- Immunofluorescence, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 0.97 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 382-481 of human HTR2B (NP_000858.3). LFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human HTR1B / 5-HT2B Receptor
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:344564
