CCL5 / RANTES Antibody
Product Sizes
100 ul
£ POA
LS-C334183-100UL
20 ul
£ POA
LS-C334183-20UL
About this Product
- SKU:
- LS-C334183
- Additional Names:
- CCL5, Chemokine (C-C motif) ligand 5, D17S136E, EoCP, T-cell specific protein p288, SCYA5, SISd, T cell-specific protein P228, Beta-chemokine RANTES, C-C motif chemokine 5, RANTES, SIS-delta, Small-inducible cytokine A5, T-cell-specific protein RANTES, TCP228
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-91 of human CCL5 (NP_002976.2). SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human CCL5 / RANTES
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:344542
