IGF2BP2 Antibody
Product Sizes
100 ul
£ POA
LS-C332239-100UL
20 ul
£ POA
LS-C332239-20UL
About this Product
- SKU:
- LS-C332239
- Additional Names:
- IGF2BP2, IMP2, IGF2 mRNA-binding protein 2, p62, VICKZ2, IGF-II mRNA-binding protein 2, IMP-2, VICKZ family member 2
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 500 to the C-Terminus of human IGF2BP2 (NP_006539.3). NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human IGF2BP2
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:342598
