IL8 / Interleukin 8 Antibody
Product Sizes
100 ul
£ POA
LS-C332151-100UL
20 ul
£ POA
LS-C332151-20UL
About this Product
- SKU:
- LS-C332151
- Additional Names:
- CXCL8, 3-10C, AMCF-I, B-ENAP, C-X-C motif chemokine 8, GCP-1, IL-8, IL8, Interleukin-8, K60, LECT, GCP1, LUCT, NAF, NAP1, Neutrophil-activating factor, Interleukin 8, Protein 3-10C, MDNCF, TSG-1, Emoctakin, LYNAP, MONAP, NAP-1, SCYB8, T-cell chemotactic factor
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 21-99 of human IL8 (NP_000575.1). EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human IL8
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:342510
