IL24 Antibody
Product Sizes
100 ul
£ POA
LS-C331744-100UL
20 ul
£ POA
LS-C331744-20UL
About this Product
- SKU:
- LS-C331744
- Additional Names:
- IL24, FISP, IL10B, IL-24, IL-4-induced secreted protein, Interleukin 24, Interleukin-24, Melanocyte-associated Mda-7, Mob-5, ST16, Mda-7, MDA7, MOB5, C49A
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 52-140 of human IL24 (NP_001172085.1). GQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFST
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human IL24
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:342103
