S100A8 / MRP8 Antibody
Product Sizes
100 ul
£ POA
LS-C331639-100UL
20 ul
£ POA
LS-C331639-20UL
About this Product
- SKU:
- LS-C331639
- Additional Names:
- S100A8, 60B8AG, CFAG, CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, Cystic fibrosis antigen, CGLA, L1Ag, NIF, p8, Protein S100-A8, MRP8, Urinary stone protein band A, CP-10, MA387, MRP-8
- Application:
- IHC-Paraffin, Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 4.445 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human S100A8 (NP_002955.2). MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human S100A8 / MRP8
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341998
