SAA1 / SAA / Serum Amyloid A Antibody
Product Sizes
100 ul
£ POA
LS-C331617-100UL
20 ul
£ POA
LS-C331617-20UL
About this Product
- SKU:
- LS-C331617
- Additional Names:
- SAA1, Serum amyloid A protein, Serum Amyloid A, Serum amyloid A-1 protein, TP53I4, SAA, Serum amyloid A1, PIG4
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 19-122 of human SAA1 (NP_000322.2). RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human SAA1 / SAA / Serum Amyloid A
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341976
