RASA1 Antibody
Product Sizes
100 ul
£ POA
LS-C331602-100UL
20 ul
£ POA
LS-C331602-20UL
About this Product
- SKU:
- LS-C331602
- Additional Names:
- RASA1, CM-AVM, CMAVM, GAP, GTPase-activating protein, PKWS, RASGAP, Ras p21 protein activator 1, Ras p21 protein activator, p120GAP, p120RASGAP, RASA
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human RASA1 (NP_002881.1). PPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSF
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human RASA1 / RASGAP
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341961
