CD3D Antibody
Product Sizes
100 ul
£ POA
LS-C331376-100UL
20 ul
£ POA
LS-C331376-20UL
About this Product
- SKU:
- LS-C331376
- Additional Names:
- CD3D, CD3 delta, CD3d antigen, T-cell receptor T3 delta chain, T3D, CD3 antigen, delta subunit, CD3-DELTA, OKT3, delta chain
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 22-105 of human CD3D (NP_000723.1). FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human CD3D
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341735
