TCF4 Antibody
Product Sizes
100 ul
£ POA
LS-C331289-100UL
20 ul
£ POA
LS-C331289-20UL
About this Product
- SKU:
- LS-C331289
- Additional Names:
- TCF4, BHLHb19, E2-2, ITF-2, ITF2, PTHS, SEF2-1B, SEF2-1, SEF2-1A, SL3-3 enhancer factor 2, SEF2, SEF-2, TCF-4, Transcription factor 4
- Application:
- Immunofluorescence, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human TCF4 (NP_001077431.1). LRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPG
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human TCF4
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341648
