ID2 Antibody
Product Sizes
100 ul
£ POA
LS-C331194-100UL
20 ul
£ POA
LS-C331194-20UL
About this Product
- SKU:
- LS-C331194
- Additional Names:
- ID2, BHLHb26, Cell growth-inhibiting gene 8, ID2H, Inhibitor of differentiation 2, GIG8, Helix-loop-helix protein ID2, ID2A, Inhibitor of DNA binding 2
- Application:
- Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2). LQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human ID2
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341553
