S100B / S100 Beta Antibody
Product Sizes
100 ul
£ POA
LS-C331058-100UL
20 ul
£ POA
LS-C331058-20UL
About this Product
- SKU:
- LS-C331058
- Additional Names:
- S100B, NEF, Protein S100-B, S100, S100 calcium binding protein B, S100 calcium-binding protein B, S100beta, S-100 protein beta chain, S-100 protein subunit beta, S100-B
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100B (NP_006263.1). MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human S100B / S100
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341417
