MAPK8 / JNK1 Antibody
Product Sizes
100 ul
£ POA
LS-C330902-100UL
20 ul
£ POA
LS-C330902-20UL
About this Product
- SKU:
- LS-C330902
- Additional Names:
- MAPK8, JNK, JNK1, JNK1A2, JNK-46, MAP kinase 8, PRKM8, SAPK1, SAPK1c, MAPK 8, C-Jun N-terminal kinase 1, JNK21B1/2, JUN N-terminal kinase
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 245-345 of human MAPK8 (NP_620635.1). CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDER
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human MAPK8 / JNK1 / JNK
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341256
