JUN / c-Jun Antibody
Product Sizes
100 ul
£ POA
LS-C330871-100UL
20 ul
£ POA
LS-C330871-20UL
About this Product
- SKU:
- LS-C330871
- Additional Names:
- JUN, Activator protein 1, AP-1, C-Jun, Jun proto-oncogene, p39, Jun oncogene, Proto-oncogene c-Jun, AP1, Enhancer-binding protein AP1, G0s7, Transcription factor AP-1, v-jun
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human JUN (NP_002219.1). MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human JUN / c-Jun
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341225
