CYP1A2 Antibody
Product Sizes
100 ul
£ POA
LS-C330782-100UL
20 ul
£ POA
LS-C330782-20UL
About this Product
- SKU:
- LS-C330782
- Additional Names:
- CYP1A2, Aryl hydrocarbon hydroxylase, Cytochrome P(3)450, Cytochrome P450 1A2, Cytochrome P450 4, p450 form 4, p3-450, p450(PA), CP12, CYPIA2, Cytochrome p450 ia2, Cytochrome P450-P3, Dioxin-inducible P3-450
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 205-305 of human CYP1A2 (NP_000752.2). FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human CYP1A2
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:341135
