POMC / Proopiomelanocortin Antibody (aa138-176)
Product Sizes
100 ug
£ POA
LS-C313433-100UG
About this Product
- SKU:
- LS-C313433
- Additional Names:
- POMC, Alpha-MSH, ACTH, Adrenocorticotropin, Adrenocorticotropic hormone, Beta-LPH, CLIP, Gamma-MSH, Lipotropin gamma, LPH, Melanotropin alpha, Met-enkephalin, Melanotropin beta, NPP, Pro-ACTH-endorphin, Lipotropin beta, Melanotropin gamma, MSH, Proopiomelanocortin, Beta-endorphin, Beta-MSH, Gamma-LPH, POC, Pro-opiomelanocortin
- Application:
- IHC-Paraffin, Immunohistochemistry
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176 aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Shipping Conditions:
- Ambient
- Specificity:
- ACTH and MSH are produced by the pituitary gland.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:323405
