ITGA3 / CD49c Antibody (Cytoplasmic Domain, clone 54B3)
Product Sizes
100 ug
£ POA
LS-C24753-100UG
About this Product
- SKU:
- LS-C24753
- Additional Names:
- ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18
- Application:
- IHC-Frozen, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.2, 0.1% Sodium Azide, No stabilizing proteins added
- translate.label.attr.clone:
- 54B3
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin a3B including an appending N-Terminus cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH.
- Isotype:
- IgG1
- Purification:
- Protein G Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Recognizes specifically the cytoplasmic domain of human integrin subunit a3B which is present in microvascular structures in brain and heart. Broad species crossreactivity is expected because of the conserved nature of the epitope.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:25335
